| Transcript | Ll_transcript_299787 |
|---|---|
| CDS coordinates | 558-893 (+) |
| Peptide sequence | MSFLIAKKYKDTIVSGYIFDINVESCVLCLSCISSFVTCYLIETTFVIEYSFMQACCIEYIILEGDNLSSLFPNAYLNLGGIELNAHTLFALIATLAVLPTVWLRDLSILSY |
| ORF Type | 3prime_partial |
| Blastp | Amino acid transporter AVT1C from Arabidopsis with 75.86% of identity |
|---|---|
| Blastx | Amino acid transporter AVT1C from Arabidopsis with 75.86% of identity |
| Eggnog | amino acid transport(COG0814) |
| Kegg | Link to kegg annotations (AT2G39130) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433817.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer