Transcript | Ll_transcript_300705 |
---|---|
CDS coordinates | 3030-4010 (+) |
Peptide sequence | MQNCQGNGRPDKDYENFRWKPSQCDIPRFDPNFFLERMRGKTLAFIGDSVARNQMESMLCILWQVEKPKNQGNRNMQRYYFRSTSVMIIRIWSSWLVKLTSEPFDYAPAGVDKLFLDVPEEKLMEHIPKFDVVVLSSGHWFAKQSVYILNNEIVGGQLWWPDKSKSMKINSVEAYRISVETILTALVTHPNYTGITIVRSYSPDHYEGGAWNTGGSCTGKVKPLAPSELVENVHTNDMHQQQVTGFNSAIKKATNKSKLKLMDITEVFQYRHDGHPGPYRSPDPNKITKRGPDGRPPPQDCLHWCMPGPVDTWNELVFEIIKRELD* |
ORF Type | complete |
Blastp | Protein trichome birefringence-like 18 from Arabidopsis with 75.15% of identity |
---|---|
Blastx | Protein trichome birefringence-like 18 from Arabidopsis with 74.86% of identity |
Eggnog | Pfam:DUF231(ENOG410XREJ) |
Kegg | Link to kegg annotations (AT4G25360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439006.1) |
Pfam | PMR5 N terminal Domain (PF14416.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer