Protein coding transcript 106993

• Transcript: Ll_transcript_298921
• CDS coordinates: 807-1238 (+)
• Peptide sequence: MNLVSPNGVSSVDWFIESLATQNQPQLKWHKAYFNAPDGVEPLALDLRSMGKGQVWINGQSIGRYWMVYAKGACNSCNYAGTYRSTKCQLGCGKPSQQWYHVPRSWLKPTKNLIVVFEEPGGNPWKISLVKRIEHTQVASELN*
• ORF Type: complete

Annotations of Ll_transcript_298921

• Blastp: Beta-galactosidase 5 from Arabidopsis with 71.97% of identity
• Blastx: Beta-galactosidase 5 from Arabidopsis with 71.59% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT1G45130)
• CantataDB: Link to cantataDB annotations (CNT0001502)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458145.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;