Protein coding transcript 107002

• Transcript: Ll_transcript_298913
• CDS coordinates: 1-408 (+)
• Peptide sequence: FINGQFLGMLLNFDSSCVCTLIESNKLHFNQHKMVIFTGSAFGTNERRSFTFNGPANLRVGTNKIALLSVAVGLPNVGFHFETWKTGIIGPVLLQGLDHGQKDLTWQKWSYQVGLKGEAMNLVYPNSVSSADWFI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_298913

• Blastp: Beta-galactosidase 5 from Arabidopsis with 70.1% of identity
• Blastx: Beta-galactosidase 5 from Arabidopsis with 69.27% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT1G45130)
• CantataDB: Link to cantataDB annotations (CNT0001502)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458145.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;