Protein coding transcript 107023

• Transcript: Ll_transcript_299872
• CDS coordinates: 3-926 (+)
• Peptide sequence: GRKKELPFLHLILIFLSLSLFDWNSKKMQQGGYAGGMVPQQQQQQHEAYMMMPPQQPTSSDEIRTLWIGDLQYWMDENYLYTCFAHTGELASLKLIRNKHTTQSEGYGFLEFTTRAAADRVLQSYNGTIMPNGGQNFRMNWASFSAGERRHDDSPDYSIFVGDLAADVTDYHLHETFSARYSSVKGAKVVIDRLTGRTKGYGFVKFADESEQIRAITEMQGVLCSTRAMRVGPASNKNPTTQPKAPYQNPQGAQSENDPNNTTIFVGNLDPDVTDDHLRQVFGQYGELVHVKIPSGKRCGFVQFSDR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_299872

• Blastp: Polyadenylate-binding protein RBP45 from Nicotiana with 71.22% of identity
• Blastx: Polyadenylate-binding protein RBP45 from Nicotiana with 73.15% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463041.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;