Protein coding transcript 107025

• Transcript: Ll_transcript_299879
• CDS coordinates: 466-1518 (+)
• Peptide sequence: MQQGGYAGGMVPQQQQQQHEAYMMMPPQQPTSSDEIRTLWIGDLQYWMDENYLYTCFAHTGELASLKLIRNKHTTQSEGYGFLEFTTRAAADRVLQSYNGTIMPNGGQNFRMNWASFSAGERRHDDSPDYSIFVGDLAADVTDYHLHETFSARYSSVKGAKVVIDRLTGRTKGYGFVKFADESEQIRAITEMQGVLCSTRAMRVGPASNKNPTTQPKAPYQNPQGAQSENDPNNTTIFVGNLDPDVTDDHLRQVFGQYGELVHVKIPSGKRCGFVQFSDRGCAEGALQALNGTILGGQNVRLSWGRSPSNKQTQTDPNQWNGGGGYYGYGQGYENYGYAPPPPGQDPNMYG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_299879

• Blastp: Polyadenylate-binding protein RBP45 from Nicotiana with 68.04% of identity
• Blastx: Polyadenylate-binding protein RBP45 from Nicotiana with 70.44% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463041.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;