Protein coding transcript 107185

• Transcript: Ll_transcript_300225
• CDS coordinates: 42-509 (+)
• Peptide sequence: MARSNSPVISIHHSQHQHRHRHRPRTSYLVSDQGSKMFLRAVARPLMAKVKQTTGIVGLDVVPNAREVLIGLYSKTLNEIKAVPEDEGYRKAVESFTSHRLKVCQEEEDWEDIEKKLGCGQVEELIEEAQDELKLISLMNGLVCFFIALFLLFWW*
• ORF Type: complete

Annotations of Ll_transcript_300225

• Blastp: Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial from Arabidopsis with 83.5% of identity
• Blastx: Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial from Arabidopsis with 83.5% of identity
• Eggnog: NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex(ENOG4111V89)
• Kegg: Link to kegg annotations (AT5G52840)
• CantataDB: Link to cantataDB annotations (CNT0000254)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453867.1)
• Pfam: ETC complex I subunit conserved region (PF04716.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;