Protein coding transcript 107188

• Transcript: Ll_transcript_300226
• CDS coordinates: 1287-1835 (+)
• Peptide sequence: MDEGGGSKLSGIRQIVRLKEILQKWQNVTLGPKTYDSKRTCPDPRRTSSEPSCGATSSSISPLINKRITSVIGCDSDEEGCLSPEPPHDVPKGYLAVYVGPELRRFIIPTTYLSHFLFKVLLEKAEDEYGFDQSGGLTIPCEIETFKYLLKCIETNPCNNFITRFNDFQMQHVSRVFDDIIG*
• ORF Type: complete

Annotations of Ll_transcript_300226

• Blastp: Indole-3-acetic acid-induced protein ARG7 from Vigna with 49.28% of identity
• Blastx: Auxin-responsive protein SAUR32 from Arabidopsis with 55.07% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414483.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;