Protein coding transcript 107190

• Transcript: Ll_transcript_300230
• CDS coordinates: 1287-1787 (+)
• Peptide sequence: MDEGGGSKLSGIRQIVRLKEILQKWQNVTLGPKTYDSKRTCPDPRRTSSEPSCGATSSSISPLINKRITSVIGCDSDEEGCLSPEPPHDVPKGYLAVYVGPELRRFIIPTTYLSHFLFKVLLEKAEDEYGFDQSGGLTIPCEIETFKYLLKCIETNPSGKSETLEE*
• ORF Type: complete

Annotations of Ll_transcript_300230

• Blastp: Auxin-responsive protein SAUR32 from Arabidopsis with 53.42% of identity
• Blastx: Auxin-responsive protein SAUR32 from Arabidopsis with 55.07% of identity
• Eggnog: Auxin-induced protein(ENOG410YXA2)
• Kegg: Link to kegg annotations (AT2G46690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414483.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;