Transcript | Ll_transcript_298729 |
---|---|
CDS coordinates | 547-1209 (+) |
Peptide sequence | MNKSSGMMMSFSDNNKSSVFTVSQWQELEHQALIFKYMLSGLPVPPHLLIPIQISISHPFFNHSSLSYSSFYGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMTQSPSTVTSVTIAGSSSATGNFQNLAANAFDNLQGSGSGTGLTDYHLDSIPYGIPSKDYRYEEILVIFHSTLLLGNGKIIWLEGIEQKVFHQCHIA* |
ORF Type | complete |
Blastp | Growth-regulating factor 4 from Oryza sativa with 66.1% of identity |
---|---|
Blastx | Growth-regulating factor 4 from Oryza sativa with 66.1% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (4330436) |
CantataDB | - |
Mirbase | osa-MIR396d (MI0013049) |
Ncbi protein | Link to NCBI protein (XP_019454355.1) |
Pfam | QLQ (PF08880.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer