Transcript | Ll_transcript_298718 |
---|---|
CDS coordinates | 219-719 (+) |
Peptide sequence | MSIANYTCKFAVSYSSFYGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMTQSPSTVTSVTIAGSSSATGNFQNLAANAFDNLQGSGSGTGLTDYHLDSIPYGIPSKDYRYEEILVIFHSTLLLGNGKIIWLEGIEQKVFHQCHIA* |
ORF Type | complete |
Blastp | Growth-regulating factor 5 from Oryza sativa with 54.31% of identity |
---|---|
Blastx | Growth-regulating factor 5 from Oryza sativa with 54.31% of identity |
Eggnog | growth-regulating factor(ENOG410YFT7) |
Kegg | Link to kegg annotations (4339928) |
CantataDB | - |
Mirbase | osa-MIR396d (MI0013049) |
Ncbi protein | Link to NCBI protein (XP_019454355.1) |
Pfam | WRC (PF08879.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer