Protein coding transcript 107291

• Transcript: Ll_transcript_298738
• CDS coordinates: 2-874 (+)
• Peptide sequence: SLQIKTSLSLSLSLPEVFSSHFSLTSLSLSLSLHFHHFPHFNEKMHSTLSLSSPITSSAATASRSHSLPFTTAKPVNLRFCGLRPEALVSTTPSLNRRHAHLPSRSHSSISAALSSNGAPPQSFDYDLLIIGAGVGGHGAALHAVEKGLKTAIVEGDVVGGTCVNRGCVPSKALLAVSGRMRELKSDHHLKSLGLQVSAASYDRQGVADHANNLATKIRSNLTNSMKALGVDILTGFGSIVGPQKVKIGSSDKVVTAKNIIIATGSVPFVPKGIEVDGTYESLSLNDINV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_298738

• Blastp: Dihydrolipoyl dehydrogenase 1, chloroplastic from Arabidopsis with 77.51% of identity
• Blastx: Dihydrolipoyl dehydrogenase 1, chloroplastic from Arabidopsis with 75.7% of identity
• Eggnog: dihydrolipoyl dehydrogenase(COG1249)
• Kegg: Link to kegg annotations (AT3G16950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455901.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;