Protein coding transcript 107314

• Transcript: Ll_transcript_299442
• CDS coordinates: 263-763 (+)
• Peptide sequence: MLGVSTLTLGSSTAMVVQSQAQHTNLNGKVLALPGSKRQSLSYKTDSLLFGFLPSTISFNESRPVRPFSTAAASVDSDQISSSDPANKNETKKYYFLVANAKFMLDEEEHFQEQLFERLRYYGESDKERDFWLVIEPKFLDKFPNITKRLKRPSVALVSTNGPWIT*
• ORF Type: complete

Annotations of Ll_transcript_299442

• Blastp: Uncharacterized protein ycf54 from Porphyra with 40.79% of identity
• Blastx: Uncharacterized protein ycf54 from Porphyra with 41.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462259.1)
• Pfam: Protein of unknown function (DUF2488) (PF10674.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;