Protein coding transcript 107386

• Transcript: Ll_transcript_299280
• CDS coordinates: 1316-1834 (+)
• Peptide sequence: MQLRIEAQGKYLQSVLEKAQEALTGYNFSTLGVEVAKAELSHLVSTINMTCPSSPKSELTETRGFNLSTGERKQNRVTMCSMESSLTYSESSEGEENQILYYESEKVQKSNTDSVKFPLLAIQLEDTRGGASEKKRRAETDSDGSCVDQPSEKRCCNKLRKSEMLEIIDLNS*
• ORF Type: complete

Annotations of Ll_transcript_299280

• Blastp: Myb family transcription factor PHL8 from Arabidopsis with 36.88% of identity
• Blastx: Myb-related protein 2 from Arabidopsis with 78.12% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG4111ACN)
• Kegg: Link to kegg annotations (AT1G69580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434082.1)
• Pfam: MYB-CC type transfactor, LHEQLE motif (PF14379.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;