Transcript | Ll_transcript_299239 |
---|---|
CDS coordinates | 577-1104 (+) |
Peptide sequence | MVQDKAYFFSSQTDHALKAFSDSDWTACPKTRRSVTGFNVFYGSSLISWKSKKQETVSRSSTEAEYRALASTACEIQWLLYLLHDLKQPLQQPIPLYCDNRSAIHIAQNPAMHERTKHIEIDCHFIRDKVQTGVIKLMPIPTVAQLADLHTKPLHPMQFQFLLSKLSIKNIYAAA* |
ORF Type | complete |
Blastp | Copia protein from Sophophora with 43.59% of identity |
---|---|
Blastx | Copia protein from Sophophora with 43.59% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017426412.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer