Protein coding transcript 107389

• Transcript: Ll_transcript_299240
• CDS coordinates: 815-1396 (+)
• Peptide sequence: MQLRIEAQGKYLQSVLKKAQEALTGYNSSTVDVKFAKAELSHLVSIMNKGCPSSPISELTETRGFSLNCGERKQNGGTMCSMESSLTSSEMEEEEEKQPQKSNTNSVELSLMAFHTEDDKGSKVDNGASGRKRNAAIDSDGSCVDQPSGKRCFNKLRKLEMLEMIDLNSQYQKDFDTSSKEIDLNCSSSFWGQ*
• ORF Type: complete

Annotations of Ll_transcript_299240

• Blastp: Myb family transcription factor PHL8 from Arabidopsis with 42.86% of identity
• Blastx: Myb family transcription factor PHL8 from Arabidopsis with 59.12% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG4111ACN)
• Kegg: Link to kegg annotations (AT1G69580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020227292.1)
• Pfam: MYB-CC type transfactor, LHEQLE motif (PF14379.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;