Protein coding transcript 107431

• Transcript: Ll_transcript_298702
• CDS coordinates: 1503-1916 (+)
• Peptide sequence: MGWQGKDPSTDFRGGGFISLENLLFFARNFPKSFQDLLRKQEGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVGATFLKFLAENESAFDLLYCITFKLMDHQWLAMRASYMDFNTVMKSTRRQLEKELLLEEI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_298702

• Blastp: ELMO domain-containing protein A from Dictyostelium with 32.64% of identity
• Blastx: ELMO domain-containing protein A from Dictyostelium with 33.33% of identity
• Eggnog: ELMO CED-12 domain containing(ENOG410XRXC)
• Kegg: Link to kegg annotations (DDB_G0278051)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453137.1)
• Pfam: ELMO/CED-12 family (PF04727.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;