Protein coding transcript 107437

• Transcript: Ll_transcript_298687
• CDS coordinates: 416-940 (+)
• Peptide sequence: MFADITNCVAEIVAGSTAWLGKGLSCVCAQRRESESRPSFDLTPVQEECLQRIQSRIDVPYDSSIPEHQDALKALWDTAFPEEKLHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLFFARNFPVCLFLILFILCDAITNILEHLFRHGPKRMFFFACSYPLLPCIVSLFWW*
• ORF Type: complete

Annotations of Ll_transcript_298687

• Blastp: ELMO domain-containing protein A from Dictyostelium with 43.75% of identity
• Blastx: ELMO domain-containing protein 2 from Homo with 45.21% of identity
• Eggnog: ELMO CED-12 domain containing(ENOG410XRXC)
• Kegg: Link to kegg annotations (DDB_G0278051)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459126.1)
• Pfam: ELMO/CED-12 family (PF04727.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;