Transcript | Ll_transcript_298684 |
---|---|
CDS coordinates | 718-1155 (+) |
Peptide sequence | MITAEVVAGSAAWLGKGLSCVCVQKRDSDASTFFDLTLAQEECLERLQRRIDVPYDSSITEHQDALRALWNAAFPGEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLYFSRNFPKSFQDLLWKREGDRSVWEYPFAVAGV |
ORF Type | 3prime_partial |
Blastp | ELMO domain-containing protein A from Dictyostelium with 37.84% of identity |
---|---|
Blastx | ELMO domain-containing protein A from Dictyostelium with 37.84% of identity |
Eggnog | ELMO CED-12 domain containing(ENOG410XRXC) |
Kegg | Link to kegg annotations (DDB_G0278051) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464704.1) |
Pfam | ELMO/CED-12 family (PF04727.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer