Protein coding transcript 107528

• Transcript: Ll_transcript_300849
• CDS coordinates: 312-1067 (+)
• Peptide sequence: MNKAVVVLRSSYSCSNSITKIAVIPSLFVSTRYQPHLHRNKLFPSLRKKLVSRSMADYGGKAVTTGSDVSSGNMIFEPILEDGVFRFDCSVNDRHAAYPSISFVNSRSRDTPITSDKVPSYTPTFQCLLDQQVVKLELPIGTSFYGTGEVSGQLERTGKRVFTWNTDAWGYGPGTTSLYQSHPWVLAILPNGEALGILADTTRRCEIDLRKESTIQFIAPSSYPVITFGPFASPTAVLISLSKAIGNFLRS*
• ORF Type: complete

Annotations of Ll_transcript_300849

• Blastp: Alpha-glucosidase 2 from Bacillus with 36.56% of identity
• Blastx: Alpha-glucosidase 2 from Bacillus with 36.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421474.1)
• Pfam: Galactose mutarotase-like (PF13802.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;