Protein coding transcript 107529

• Transcript: Ll_transcript_300850
• CDS coordinates: 119-1534 (+)
• Peptide sequence: MPPKWSLGYQQCRWSYLSDQRVLEVTRTFREKRIPCDVIWMDIDYMDGFRCFTFDKEHFPDPKSLVKDLHYNGFKAIWMLDPGIKLEEGYFVCDSGSKNDVWVQKADGAPFVGDVWPGPCVFPDYTQSKVREWWANLVKEFISNGVDGIWNDMNEPAIFKVVTKTMPESNVHRGDEELGGCQNHSFYHNVYGLLMAKSTYEGMKLANEKKRPFVLTRAGFVGSQRYAATWTGDNLSTWEHLHMSISMVLQMGLSGQPLSGPDIGGFAGNASPRLFGRWMGIGSLFPFCRGHSEKSTSDHEPWSFGEECEEVCRLALKRRYRLIPLIYTLFYFAHTRGTPVATPTFFADPKDPTLRKLENSFLLGPVLVYASTLRDQGLDKLDCTLPKGIWLSFDFDDVHPDLPALFLKGGSIIPLGLPIQHVGEANPSDDLTLLVALDEHGKAEGFLFEDDGDGYEFTKGKYLLTHYVAELQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_300850

• Blastp: Alpha-glucosidase 2 from Bacillus with 41.37% of identity
• Blastx: Alpha-glucosidase 2 from Bacillus with 41.02% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421474.1)
• Pfam: Glycosyl hydrolases family 31 (PF01055.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;