Protein coding transcript 107597

• Transcript: Ll_transcript_300521
• CDS coordinates: 78-545 (+)
• Peptide sequence: MACRQLWASRAASYFRISVFNRAFSTVLKDLKYADSHEWVKVDGNSATVGITDHAQDHLGDVVYVELPEVGATVTQGEGFGAVESVKATSDINSPVSGKVVEVNEELSSSPALVNSSPYNNGWIIKVELSDNGEVNNLMDSDQYSKFCEEEDSNH*
• ORF Type: complete

Annotations of Ll_transcript_300521

• Blastp: Glycine cleavage system H protein 2, mitochondrial from Arabidopsis with 80.13% of identity
• Blastx: Glycine cleavage system H protein 2, mitochondrial from Arabidopsis with 80.13% of identity
• Eggnog: The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein (By similarity)(COG0509)
• Kegg: Link to kegg annotations (AT2G35120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445859.1)
• Pfam: Glycine cleavage H-protein (PF01597.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;