Protein coding transcript 1076

• Transcript: Ll_transcript_395868
• CDS coordinates: 129-995 (+)
• Peptide sequence: MAASSNSLSLKNHPLIFPNPNSKPLTQFAIGSRNHHQQNRWLSLKLKCSFTETDKVVVGEYPKPSEIQWKKELCNSVNLIGIVASPVEIKHFPSGTVVAWTRITVKKNATQSSWINLSFWNEMAHIAHQHLQKGNQIFVSGRLTADTVETDDGKTQTYYKVIVQQLNFIERSFSSVSSHDQDFDSAIPANSGKKVSYSANSTGSVVELWNTFFANPGEWWDNRKNKKNPKGPDFKHKDTGEALWVEGRSNPPWVKSQLAILDSRMGSNAAPNTRMPVHMMNADEILSF*
• ORF Type: complete

Annotations of Ll_transcript_395868

• Blastp: Protein OSB1, mitochondrial from Arabidopsis with 35.89% of identity
• Blastx: Protein OSB1, mitochondrial from Arabidopsis with 35.89% of identity
• Eggnog: Single-strand binding protein family(ENOG410YN9V)
• Kegg: Link to kegg annotations (AT1G47720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428737.1)
• Pfam: Single-strand binding protein family (PF00436.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;