Protein coding transcript 107657

• Transcript: Ll_transcript_300487
• CDS coordinates: 297-827 (+)
• Peptide sequence: MTNMIQIQQSSMRIEEVSNMTMMQKKQGIVTILESNFGDTKTPSEQSSLRRTLSADMSSQKWVSHETIKNVPSSEEIMQQNSSSCKTIADSLSSDEAEAERERLEIWSSIQRNKKEEKEKAGTYAFDMWNSLVSLKDNNEISKSLPASPYIHPLVKRTKSCLSEKSLEICTESLGSE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_300487

• Blastp: Protein FAF-like, chloroplastic from Arabidopsis with 44.16% of identity
• Blastx: Protein FAF-like, chloroplastic from Arabidopsis with 44.16% of identity
• Eggnog: expressed protein(ENOG410YQ65)
• Kegg: Link to kegg annotations (AT5G22090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413316.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;