Protein coding transcript 107658

• Transcript: Ll_transcript_300502
• CDS coordinates: 175-648 (+)
• Peptide sequence: MQASRARLFKEYKEVQREKSADPDITLVCDDSNIFKWNALIKGPSETPFEGGVFQLAFSVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGFQSMARMYTRLAAMPKKG*
• ORF Type: complete

Annotations of Ll_transcript_300502

• Blastp: Protein PEROXIN-4 from Arabidopsis with 94.27% of identity
• Blastx: Protein PEROXIN-4 from Arabidopsis with 94.27% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT5G25760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415934.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;