Transcript | Ll_transcript_299153 |
---|---|
CDS coordinates | 243-905 (+) |
Peptide sequence | MEISVSEAIRDRRIGGLGNLRVLPDEILCAILELLTPRDAARVACVSSVMYIMCNEEPLWMSLCLKGVSGLLQYKGSWKKTALHIENLPDKYKEHDRRPLHFDGFSSLFLYRRLYRCHTTLDAFHADNGSVERIKDISLKDFYDTYDAKKPVMLTGLADTWPARHKWTTEQLLLNYGDVAFKISQRSARKVSMKLNDYVSYTEVQHDEDPLYIFDEKVLV* |
ORF Type | complete |
Blastp | F-box protein At1g78280 from Arabidopsis with 61.06% of identity |
---|---|
Blastx | F-box protein At1g78280 from Arabidopsis with 61.06% of identity |
Eggnog | jumonji domain containing 6(ENOG410XQCR) |
Kegg | Link to kegg annotations (AT1G78280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415322.1) |
Pfam | F-box-like (PF12937.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer