Protein coding transcript 107677

• Transcript: Ll_transcript_299153
• CDS coordinates: 243-905 (+)
• Peptide sequence: MEISVSEAIRDRRIGGLGNLRVLPDEILCAILELLTPRDAARVACVSSVMYIMCNEEPLWMSLCLKGVSGLLQYKGSWKKTALHIENLPDKYKEHDRRPLHFDGFSSLFLYRRLYRCHTTLDAFHADNGSVERIKDISLKDFYDTYDAKKPVMLTGLADTWPARHKWTTEQLLLNYGDVAFKISQRSARKVSMKLNDYVSYTEVQHDEDPLYIFDEKVLV*
• ORF Type: complete

Annotations of Ll_transcript_299153

• Blastp: F-box protein At1g78280 from Arabidopsis with 61.06% of identity
• Blastx: F-box protein At1g78280 from Arabidopsis with 61.06% of identity
• Eggnog: jumonji domain containing 6(ENOG410XQCR)
• Kegg: Link to kegg annotations (AT1G78280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415322.1)
• Pfam: F-box-like (PF12937.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;