Protein coding transcript 107683

• Transcript: Ll_transcript_299169
• CDS coordinates: 1-333 (+)
• Peptide sequence: AASGDSKVFYLKMKGDYHRYLAEFKTGTERKDAAENTLNAYKAAQDIANGELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGAGSYTDSTLIMQ
• ORF Type: internal

Annotations of Ll_transcript_299169

• Blastp: 14-3-3 protein 5 from Lycopersicon with 91.89% of identity
• Blastx: 14-3-3 protein 5 from Lycopersicon with 91.89% of identity
• Eggnog: Tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein(COG5040)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433966.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;