Protein coding transcript 107737

• Transcript: Ll_transcript_299969
• CDS coordinates: 386-724 (+)
• Peptide sequence: MELVLTEEDAAQWVYRGEGAVNLVLSYTGSSPSFIGKVMRIRKVPRNGSKGVKSSNLALNEHECLVWKDVVELISSSDEEIANQQYLQHVIQPLLGSKFIDAGVCNFFPCTR*
• ORF Type: complete

Annotations of Ll_transcript_299969

• Blastp: Inositol-pentakisphosphate 2-kinase from Arabidopsis with 51.4% of identity
• Blastx: Inositol-pentakisphosphate 2-kinase from Arabidopsis with 51.4% of identity
• Eggnog: inositol 1,3,4,5,6-pentakisphosphate 2-kinase(ENOG410XSF2)
• Kegg: Link to kegg annotations (AT5G42810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436899.1)
• Pfam: Inositol-pentakisphosphate 2-kinase (PF06090.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;