Transcript | Ll_transcript_299981 |
---|---|
CDS coordinates | 158-1333 (+) |
Peptide sequence | MLASDPSFVLRPIASIPDPNPTRSLLFSARFCFDPRSWFRPSFAVGPKLSFNSVERVVLRRIRCGCFKNHRMKVEEDSGGGDLFDAATVKPVPYHLVIMVNGIIGSASDWRYAAEQFVKKLPDKVVVHRSECNSSKLTFDGVDTMGERLAEEVLSVIRRWPEVQKISFVAHSLGGLVARYAIGRLYEYSSTLEPLGTNRNCSIEEKTEYSKQFLEQRNEAKIAGLEPMNFITFATPHLGSRGNRQLPFLCGLPFLERSASQTAHLVAGRSGKHLFLMDNDEGKPPLLLRMVDDSDDLKFMSALRAFKRRVAYANANYDHMVGWRTSSIRRQHELPKSNLLVIDAKYPHIVYIEGDTVDAIHNKASSNIIGQTVELEGYLLIFFRRFYQFIT* |
ORF Type | complete |
Blastp | Putative lipase YOR059C from Saccharomyces with 26.34% of identity |
---|---|
Blastx | Putative lipase YOR059C from Saccharomyces with 26.34% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YOR059C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417721.1) |
Pfam | Putative serine esterase (DUF676) (PF05057.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer