Protein coding transcript 107743

• Transcript: Ll_transcript_299981
• CDS coordinates: 158-1333 (+)
• Peptide sequence: MLASDPSFVLRPIASIPDPNPTRSLLFSARFCFDPRSWFRPSFAVGPKLSFNSVERVVLRRIRCGCFKNHRMKVEEDSGGGDLFDAATVKPVPYHLVIMVNGIIGSASDWRYAAEQFVKKLPDKVVVHRSECNSSKLTFDGVDTMGERLAEEVLSVIRRWPEVQKISFVAHSLGGLVARYAIGRLYEYSSTLEPLGTNRNCSIEEKTEYSKQFLEQRNEAKIAGLEPMNFITFATPHLGSRGNRQLPFLCGLPFLERSASQTAHLVAGRSGKHLFLMDNDEGKPPLLLRMVDDSDDLKFMSALRAFKRRVAYANANYDHMVGWRTSSIRRQHELPKSNLLVIDAKYPHIVYIEGDTVDAIHNKASSNIIGQTVELEGYLLIFFRRFYQFIT*
• ORF Type: complete

Annotations of Ll_transcript_299981

• Blastp: Putative lipase YOR059C from Saccharomyces with 26.34% of identity
• Blastx: Putative lipase YOR059C from Saccharomyces with 26.34% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YOR059C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417721.1)
• Pfam: Putative serine esterase (DUF676) (PF05057.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;