| Transcript | Ll_transcript_299546 |
|---|---|
| CDS coordinates | 207-629 (+) |
| Peptide sequence | MASISATSLMFKPSLKLSSSTTQASYRISSLRTISVGWTKRSSPSLRTTGFRISCAVQPKTLEKVVEVVKKQLALPAETELTPDTKFTALGADSLDTVEIVMNLEEEFGINVENENSENITTVQEAAELIEKLIQKKGEA* |
| ORF Type | complete |
| Blastp | Acyl carrier protein 4, chloroplastic from Cuphea with 53.52% of identity |
|---|---|
| Blastx | Acyl carrier protein 4, chloroplastic from Cuphea with 52.82% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416157.1) |
| Pfam | Phosphopantetheine attachment site (PF00550.24) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer