Protein coding transcript 107828

• Transcript: Ll_transcript_299079
• CDS coordinates: 127-1020 (+)
• Peptide sequence: MGGYEEEYQKFVESCDICQRNKYSTLAPAGLLQPLPIPQQVWMDISMDFIRGLPRVRGKDTILVVVDRLTKYAHFFYALGHPFTAKDVAALFLKEVVKLHGFPTTIVSDRDPLFLSQFWKELFKMAETQLKLSTFYHPQTDGQSEVTNRCLETYLRCFVGPKPKQWVEWFHWAEFWFNSNYNTSAGMTPFKALYGRETPILLKAGTVPSRVEEVNRLYRQRDDVLEELKGNLAKAQNLMKQYADKHRRFLEFKVGDWVFLKLQPYKMKSIATRPCAKLAPIFYGPYQVTKRIGEVAY*
• ORF Type: complete

Annotations of Ll_transcript_299079

• Blastp: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 33.45% of identity
• Blastx: Transposon Tf2-8 polyprotein from Schizosaccharomyces with 33.33% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC167.08)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459958.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;