Transcript | Ll_transcript_298104 |
---|---|
CDS coordinates | 557-1150 (+) |
Peptide sequence | MSASIAAFERPRPGASNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLFEWKTSLEQALTQAPSAALVMGHNGIFRNDTSDSIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKYGKL* |
ORF Type | complete |
Blastp | Rho GTPase-activating protein 7 from Arabidopsis with 83.59% of identity |
---|---|
Blastx | Rho GTPase-activating protein 7 from Arabidopsis with 83.59% of identity |
Eggnog | rho GTPase activating protein(ENOG410XR4E) |
Kegg | Link to kegg annotations (AT5G19390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461529.1) |
Pfam | PH domain (PF00169.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer