Protein coding transcript 107897

• Transcript: Ll_transcript_298104
• CDS coordinates: 557-1150 (+)
• Peptide sequence: MSASIAAFERPRPGASNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLFEWKTSLEQALTQAPSAALVMGHNGIFRNDTSDSIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKYGKL*
• ORF Type: complete

Annotations of Ll_transcript_298104

• Blastp: Rho GTPase-activating protein 7 from Arabidopsis with 83.59% of identity
• Blastx: Rho GTPase-activating protein 7 from Arabidopsis with 83.59% of identity
• Eggnog: rho GTPase activating protein(ENOG410XR4E)
• Kegg: Link to kegg annotations (AT5G19390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461529.1)
• Pfam: PH domain (PF00169.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;