Protein coding transcript 10791

• Transcript: Ll_transcript_283461
• CDS coordinates: 232-540 (+)
• Peptide sequence: MSANPLQALFHNFDQVSKFVQYHLSNFIGFHLQPSGPSARGPIFSISSSSKALPLAKITPVNPGDNALKGKSATPAAKEELGRATWTFLHTLAAQVLILQFY*
• ORF Type: complete

Annotations of Ll_transcript_283461

• Blastp: FAD-linked sulfhydryl oxidase ERV1 from Arabidopsis with 45.54% of identity
• Blastx: FAD-linked sulfhydryl oxidase ERV1 from Arabidopsis with 45.54% of identity
• Eggnog: thiol oxidase activity(COG5054)
• Kegg: Link to kegg annotations (AT1G49880)
• CantataDB: Link to cantataDB annotations (CNT0000758)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447568.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;