| Transcript | Ll_transcript_298113 |
|---|---|
| CDS coordinates | 221-625 (+) |
| Peptide sequence | MMSSTSTSFASNVPQSTFLELPLTTNNRFSLRFSAKSHHRVSAFSDQRPEGPYCVYVGPLETANQETLEALYSQARDAYYSGEPLIVDDMFDRVELKLRRFGSKSVVKYPRCSIRRQSTFADAEGRKIYLWFWH* |
| ORF Type | complete |
| Blastp | PGR5-like protein 1B, chloroplastic from Arabidopsis with 37.04% of identity |
|---|---|
| Blastx | - |
| Eggnog | PGR5-like protein 1A(ENOG4110C1Q) |
| Kegg | Link to kegg annotations (AT4G11960) |
| CantataDB | Link to cantataDB annotations (CNT0000173) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414058.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer