Transcript | Ll_transcript_298115 |
---|---|
CDS coordinates | 221-625 (+) |
Peptide sequence | MMSSTSTSFASNVPQSTFLELPLTTNNRFSLRFSAKSHHRVSAFSDQRPEGPYCVYVGPLETANQETLEALYSQARDAYYSGEPLIVDDMFDRVELKLRRFGSKSVVKYPRCSIRRQSTFADAEGRKIYLWFWH* |
ORF Type | complete |
Blastp | PGR5-like protein 1B, chloroplastic from Arabidopsis with 37.04% of identity |
---|---|
Blastx | - |
Eggnog | PGR5-like protein 1A(ENOG4110C1Q) |
Kegg | Link to kegg annotations (AT4G11960) |
CantataDB | Link to cantataDB annotations (CNT0000168) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414058.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer