Protein coding transcript 107948

• Transcript: Ll_transcript_300778
• CDS coordinates: 577-1143 (+)
• Peptide sequence: MVGSPDLISIPGETGKLYEANVDDVGYRLVAIYTPVREDGVEGQPISVSTEPIVVEPDVLKEVKQNLDLGSVKFEVLCDKDQTSKKVSTLGTYMRRILEVNRKRIKVVKSATKTSFPTTEIRGSYAPPFHVEIFRNDQHRLKIVVDSENEADLMVHSRHSRDVIVLVIRGLAQRFNSTSLNSLLKIET*
• ORF Type: complete

Annotations of Ll_transcript_300778

• Blastp: 187-kDa microtubule-associated protein AIR9 from Arabidopsis with 76.06% of identity
• Blastx: 187-kDa microtubule-associated protein AIR9 from Arabidopsis with 75.27% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT2G34680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416977.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;