Transcript | Ll_transcript_300785 |
---|---|
CDS coordinates | 2407-2832 (+) |
Peptide sequence | MFDEKYYAKFDSVVSWSPSWLTTCLPWQVLCDKDQTSKKVSTLGTYMRRILEVNRKRIKVVKSATKTSFPTTEIRGSYAPPFHVEIFRNDQHRLKIVVDSENEADLMVHSRHSRDVIVLVIRGLAQRFNSTSLNSLLKIET* |
ORF Type | complete |
Blastp | 187-kDa microtubule-associated protein AIR9 from Arabidopsis with 71.67% of identity |
---|---|
Blastx | 187-kDa microtubule-associated protein AIR9 from Arabidopsis with 76% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT2G34680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416977.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer