Protein coding transcript 108030

• Transcript: Ll_transcript_408162
• CDS coordinates: 233-787 (+)
• Peptide sequence: MQIAVIEFARSILGLLDANSTEFDPEAKTPCVLFMPEGSKTHMGGTMRLGSRRTYFQVADCKSAKLYGNASFVDERHRHRYEVNPDMISQFESAGLSFVGKDETGRRMEIIELPGHPFFVGAQFHPEFKSRPGKPSPLFSGLIVAACKMSRTFLPASNGHAKLTKGIHNGHLSVNTHTGNGSKSP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_408162

• Blastp: CTP synthase 2 from Xenopus with 61.04% of identity
• Blastx: CTP synthase 2 from Xenopus with 62.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444477)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413916.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;