Protein coding transcript 108042

• Transcript: Ll_transcript_408182
• CDS coordinates: 1156-2070 (+)
• Peptide sequence: MVGKYTGLSDAYLSVLKALLHASVAHNHKLIVDWVPAEHLEDVTFKENPDAHEAAWGLLKGANGILVPGGFGDRGVQGKILAAKFARENNVPFLGICLGMQIAVIEFARSILGLLDANSTEFDPEAKTPCVLFMPEGSKTHMGGTMRLGSRRTYFQVADCKSAKLYGNASFVDERHRHRYEVNPDMISQFESAGLSFVGKDETGRRMEIIELPGHPFFVGAQFHPEFKSRPGKPSPLFSGLIVAACKMSRTFLPASNGHAKLTKGIHNGHLSVNTHTGNGSKSPNGSIYGVHTNGNGLHADGSC*
• ORF Type: complete

Annotations of Ll_transcript_408182

• Blastp: CTP synthase 2 from Xenopus with 58.1% of identity
• Blastx: CTP synthase from Dictyostelium with 68.77% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444477)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413914.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;