Protein coding transcript 108089

• Transcript: Ll_transcript_410710
• CDS coordinates: 420-923 (+)
• Peptide sequence: MCCNVDLSRMYFLTLLKSQFAGSGVSTDIWTSYAARIMVLSVIPFLIVQLPQLLSSTSGRHFAILIALVVSICLLIVYCLYQVFQPWIQRRKLSYVKHKHVILGLLKHLKQRALGRLLTENGEPNIKIIEKLFDTIDENKDGELSHGELKALVVGIQFEEVDLDHEDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_410710

• Blastp: Sodium/calcium exchanger NCL from Arabidopsis with 66.44% of identity
• Blastx: Sodium/calcium exchanger NCL from Arabidopsis with 66.44% of identity
• Eggnog: Calcium-binding EF hand family protein(ENOG410ZVKW)
• Kegg: Link to kegg annotations (AT1G53210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443893.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;