| Transcript | Ll_transcript_410702 |
|---|---|
| CDS coordinates | 420-791 (+) |
| Peptide sequence | MCCNVDLSRMYFLTLLKSQFAGSGVSTDIWTSYAARIMVLSVIPFLIVQLPQLLSSTSGRHFAILIALVVSICLLIVYCLYQVNFFLWCNCFSFCILISFYIQTLLVLLIVFCIYICTYTFHQ* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Sodium/calcium exchanger NCL from Arabidopsis with 72% of identity |
| Eggnog | Calcium-binding EF hand family protein(ENOG410ZVKW) |
| Kegg | Link to kegg annotations (AT1G53210) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456227.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer