Protein coding transcript 108098

• Transcript: Ll_transcript_410704
• CDS coordinates: 2407-2991 (+)
• Peptide sequence: MKFLSDFHDETRREHDLLDVGGHDDEVDEGVGNAGWTSIKAVLLLVLGSLIAAAFADPLVDAVNNFSNATSIPAFFISFIALPLATNSSEAVSAIIFASRDKRQTASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILVVCIVMGGIGSFRTTFPLWTSIVAILLYPFSLALVYVLDYVFGWS*
• ORF Type: complete

Annotations of Ll_transcript_410704

• Blastp: Sodium/calcium exchanger NCL1 from Oryza sativa with 72.02% of identity
• Blastx: Sodium/calcium exchanger NCL1 from Oryza sativa with 63.93% of identity
• Eggnog: Calcium-binding EF hand family protein(ENOG410ZVKW)
• Kegg: Link to kegg annotations (4325568)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443893.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;