Protein coding transcript 1081

• Transcript: Ll_transcript_428337
• CDS coordinates: 3-326 (+)
• Peptide sequence: FVKMAHLHSAAKGKLLAVIGDEDTCVGFLLGGVGEINKNRQPNFMVVDRNTSISEIDECFKRFVKRDDIDIILINQNVAEMVRHCIDSHTQPVPAVLEIPSKDHPYDA
• ORF Type: internal

Annotations of Ll_transcript_428337

• Blastp: V-type proton ATPase subunit F from Manduca with 85.29% of identity
• Blastx: V-type proton ATPase subunit F from Manduca with 85.29% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425902.1)
• Pfam: ATP synthase (F/14-kDa) subunit (PF01990.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;