Protein coding transcript 108104

• Transcript: Ll_transcript_408644
• CDS coordinates: 110-1081 (+)
• Peptide sequence: MKEVDVMFHAQKIRQARREKGKDCFIFKVDFEKAYDSVNWSFLLYMMDRMGFCFRWRSWIKSCLQSNSVSVLVNGSPTSEFSMARGLRQGDPIAPFLFLIVVEGLAGLMRSAVSKNIFKGYQVGRNKVQISHLQYADDTLLIGENSLANITVLKGILKCFELSSGLRINFHKSSFMGINSGDNLVERAVGKLFCKIGSVPFKFLGIPVGANPRRISTWSPVIDVFKRRLSSWNQKLISFSGRVTLIKSVLSALPIYYFSFFKAPVSVIAELNRIQRRFLWGRGEESKGIHWVSWDKVCRSKGEGGLGIKNLSLFNLSLLGKWR*
• ORF Type: complete

Annotations of Ll_transcript_408644

• Blastp: LINE-1 retrotransposable element ORF2 protein from Homo with 28.1% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 30.29% of identity
• Eggnog: NA(ENOG410Y9TZ)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418409.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;