Transcript | Ll_transcript_408872 |
---|---|
CDS coordinates | 320-730 (+) |
Peptide sequence | MATELGLGLEITELRLGLPCGEHMHVDKNEKKRVFSEIKGGGDEKNSGDRIMATKNQVVGWPPVCSHRKKNNTNEASKPYVKVSMDGAPFLRKIDLGMHKGYSELALALEKLFGCYGIGKLYCVFLFLSLELNLHY* |
ORF Type | complete |
Blastp | Auxin-induced protein 22A from Vigna with 73.81% of identity |
---|---|
Blastx | Auxin-induced protein 22A from Vigna with 71.3% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448128.1) |
Pfam | AUX/IAA family (PF02309.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer