Transcript | Ll_transcript_283779 |
---|---|
CDS coordinates | 1000-1407 (+) |
Peptide sequence | MSIWFLQEGRIDEDGNLQCSYHGWSFDGCGSCVKIPQAMSEGPEARAVRSPRACATRFPTLVSQGLLFVWPDENGWEKANASQPPLLPDDFEKPEFATVNIQRDLFYGYDTLMENVSDPSHIDFAHHKVQIILSN* |
ORF Type | complete |
Blastp | Pheophorbide a oxygenase, chloroplastic from Arabidopsis with 81.45% of identity |
---|---|
Blastx | Pheophorbide a oxygenase, chloroplastic from Arabidopsis with 73.39% of identity |
Eggnog | rieske 2fe-2S domain-containing protein(COG4638) |
Kegg | Link to kegg annotations (AT3G44880) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413798.1) |
Pfam | Rieske [2Fe-2S] domain (PF00355.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer