Transcript | Ll_transcript_410625 |
---|---|
CDS coordinates | 1050-1511 (+) |
Peptide sequence | MATMLNGAAIMDGALLLIAANESCPQPQTSEHLAAVEIMRLQHIIILQNKVDLIQENVAINQHEAIQKFIQGTVADGAPVVPISAQLKYNIDVVCEYIVKRIPIPERNFISPPNMIVIRSFDVNKPGFEVDDIKGGVAGGSILRVSFLVNIPI* |
ORF Type | complete |
Blastp | Eukaryotic translation initiation factor 2 subunit 3 from Homo with 76.39% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 2 subunit 3, Y-linked from Mus with 77.18% of identity |
Eggnog | translation initiation factor(COG5257) |
Kegg | Link to kegg annotations (1968) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461644.1) |
Pfam | Elongation factor Tu GTP binding domain (PF00009.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer