Protein coding transcript 108203

• Transcript: Ll_transcript_410628
• CDS coordinates: 2237-2947 (+)
• Peptide sequence: MATMLNGAAIMDGALLLIAANESCPQPQTSEHLAAVEIMRLQHIIILQNKVDLIQENVAINQHEAIQKFIQGTVADGAPVVPISAQLKYNIDVVCEYIVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDDIKGGVAGGSILRGVLKVNQFIEVRPGIVVKDEVGNIKCTPIYSRIVSLFAEQNELQFAVPGGLIGVGTTMDPTLTRADRLVGQVLGAVGSLPEVFVELEVGGHV*
• ORF Type: complete

Annotations of Ll_transcript_410628

• Blastp: Eukaryotic translation initiation factor 2 subunit 3 from Sophophora with 75.85% of identity
• Blastx: Eukaryotic translation initiation factor 2 subunit 3 from Sophophora with 76.35% of identity
• Eggnog: translation initiation factor(COG5257)
• Kegg: Link to kegg annotations (Dmel_CG43665)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461644.1)
• Pfam: Elongation factor Tu GTP binding domain (PF00009.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;