Protein coding transcript 108250

• Transcript: Ll_transcript_409111
• CDS coordinates: 1552-2619 (+)
• Peptide sequence: MAFHECGGNDSTDALIALPQWVLEIGKDNRDIFFTDREGRRNTECLSWGIDKERVLKGRTGIEVYFDFMRSFRTEFDDLFAEGLISAVEIGLGASGELKYPSFSERMGWRYPGIGEFQCYDKYLQHSLHRAAKSRGHSFWARGPDNAGNYNSMPHETGFFCDRGDYDNYYGRFFLHWYFQTLIDHADNVLSLASLAFEETKIIVKVPAVYWWYKTASHAAELTAGYHNPTNQDGYSPVFEVLRKHDVTVKFICLGVQLSSQEADESLADPEGFSWQVLNSAWDRGLMTAGENALPCYDREGYKRLVEMAKPRNDPDRRHFSFFVCQQPSLLQGNVCLTELDFFIKCLHGEMAGDL*
• ORF Type: complete

Annotations of Ll_transcript_409111

• Blastp: Beta-amylase 8 from Arabidopsis with 72.16% of identity
• Blastx: Beta-amylase 8 from Arabidopsis with 72.11% of identity
• Eggnog: beta-amylase(ENOG410YA7C)
• Kegg: Link to kegg annotations (AT5G45300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423336.1)
• Pfam: Glycosyl hydrolase family 14 (PF01373.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;