Protein coding transcript 108361

• Transcript: Ll_transcript_408254
• CDS coordinates: 752-1078 (+)
• Peptide sequence: MASVFGYAAGVARGMAPGAHIAVYKVCWFNGCYNSDIMAAMDMAIRDGVDILSLSLGGFPVPLFDDSIAIGSFRAMEHGISVICAAGNNGPTEMSVANEAPLINTVGAS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_408254

• Blastp: Subtilisin-like protease SBT1.2 from Arabidopsis with 78.7% of identity
• Blastx: Subtilisin-like protease SBT1.2 from Arabidopsis with 67.71% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT1G04110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444439.1)
• Pfam: Subtilase family (PF00082.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;